Cagrilintide (10MG)Availability: 48 in stock
$89.99
Shipping Calculated at checkout.
Availability: 48 in stock
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular Weight: 4,409.01 g/mol
CAS Number: 1415456-99-3
Synonyms: AM833, AT42613
Structure Features: The peptide is acylated with a C20 di-acid fatty chain, which improves albumin binding and extends its biological half-life to approximately 160–190 hours in test systems.
Form: White lyophilized powder, soluble in aqueous buffers.
Appetite Regulation and Gastric Emptying — Studies indicate Cagrilintide activates amylin receptors in the brainstem regions (e.g., area postrema and nucleus tractus solitarius), leading to reduced food intake and delayed gastric emptying.
Energy and Weight Research Models — In experimental settings, Cagrilintide has been shown to enhance energy balance and contribute to weight reduction when administered alone or in combination with GLP-1 receptor agonists. Combination studies (e.g., with semaglutide) demonstrated synergistic effects in reducing body weight and improving metabolic parameters in research animals.
Metabolic & Glycemic Modulation — Data from preclinical and early human research demonstrate reductions in glucagon levels, modest improvements in fasting glucose, and better insulin sensitivity in metabolic studies.
Pharmacokinetic Advantages — Due to its acylated structure, Cagrilintide exhibits a long elimination half-life (~160–195 hours), supporting sustained receptor engagement and stable activity with once-weekly administration schedules in experimental contexts.
Safety Observations — Controlled research trials report gastrointestinal events (e.g., transient nausea or fullness) as the most common findings, similar to other amylin analogs. No endocrine-related toxicities have been documented under study conditions.
Purity: ≥99% (HPLC verified)
Solubility: Water and aqueous buffers
Storage: Store at –20°C, sealed and protected from light and moisture
Shelf Life: 36 months when stored properly
Manufacturing: USA-made, GMP-compliant, third-party tested for sterility and purity
Intended Use: In vitro and laboratory research only — not for human use
This compound is sold exclusively for research purposes. It is not approved for human or veterinary consumption, medical use, or as a dietary supplement. Handle only by qualified individuals with appropriate laboratory training. Keep out of reach of children. The supplier guarantees the purity and identity of the material only.
Cagrilintide (10MG)
| 5 star | 0% | |
| 4 star | 0% | |
| 3 star | 0% | |
| 2 star | 0% | |
| 1 star | 0% |
Sorry, no reviews match your current selections
4.6
17 Reviews
I decided to try something new with Iron Peptides, and it has already been very beneficial. Since starting, I’ve noticed many positive effects. I feel motivated to continue, and I’m confident I’ve found the right company to trust on my personal journey—Iron Peptides.
The products, services and information is exceptional

Fist time trying peptides to see what all the hype was about. And. I AM HOOKED! Have never felt. Better. 5 months after my neck surgery and I feel amazing. Recovery was easy and I have all my strength back!!
I decided to try something new with Iron Peptides, and it has already been very beneficial. Since starting, I’ve noticed many positive effects. I feel motivated to continue, and I’m confident I’ve found the right company to trust on my personal journey—Iron Peptides.
The products, services and information is exceptional

Fist time trying peptides to see what all the hype was about. And. I AM HOOKED! Have never felt. Better. 5 months after my neck surgery and I feel amazing. Recovery was easy and I have all my strength back!!
Cagrilintide (10MG)Availability: 48 in stock